HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P43720

Names and origin
Entry : P43720 (reviewed)
Entry name : ATPF_HAEIN
Protein names : ATP synthase subunit b (ATP synthase F(0) sector subunit b) (ATPase subunit I) (F-type ATPase subunit b) (F-ATPase subunit b)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : atpF
ORF names : HI_0483
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; plasma membrane; plasma membrane ATP synthesis coupled proton transport; proton-transporting ATP synthase activity, rotational mechanism; proton-transporting ATP synthase complex, coupling factor F(o)
GO identifier : GO:0016021; GO:0005886; GO:0042777; GO:0046933; GO:0045263
Keywords
Ligand & Biological process : ATP synthesis; CF(0); Cell inner membrane; Cell membrane; Complete proteome; Hydrogen ion transport; Ion transport; Membrane; Reference proteome; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to ATPase B chain family
Subcellular location : Cell inner membrane; Single-pass membrane protein.
Reference
PubMed ID : 7542800
Protein sequence
Length : 168 residues
>P43720|ATPF_HAEIN Haemophilus influenzae Rd KW20
MNLNATLIGQLIAFALFVWFCMKFVWPPIINAIETRQSQIANALASAEAAKKEQADTKNL
VEQELSAAKLQAQDILDAANKRRNEVLDEVKAEAEELKAKIIAQGYAEVEAERKRVQEEL
RLKVASLAVAGAEKIVGRSIDEAANNDIIDKLVAEL