HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P43717

Names and origin
Entry : P43717 (reviewed)
Entry name : ATPD_HAEIN
Protein names : ATP synthase subunit delta (ATP synthase F(1) sector subunit delta) (F-type ATPase subunit delta) (F-ATPase subunit delta)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : atpH
ORF names : HI_0482
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : plasma membrane; plasma membrane ATP synthesis coupled proton transport; proton-transporting ATP synthase activity, rotational mechanism; proton-transporting ATP synthase complex, catalytic core F(1)
GO identifier : GO:0005886; GO:0042777; GO:0046933; GO:0045261
Keywords
Ligand & Biological process : ATP synthesis; CF(1); Cell inner membrane; Cell membrane; Complete proteome; Hydrogen ion transport; Ion transport; Membrane; Reference proteome; Transport
General annotation
Sequence similarities : Belongs to ATPase delta chain family
Subcellular location : Cell inner membrane; Peripheral membrane protein.
Reference
PubMed ID : 7542800
Protein sequence
Length : 189 residues
>P43717|ATPD_HAEIN Haemophilus influenzae Rd KW20
MSELTTIARPYAKAAFDFAIEQSAVEKWTEMLGFAAAVAEDETVKAYLSSSLSAQKLADT
VISICGEQLDQYGQNLIRLMAENKRLSAIPAVFEEFKHHVEEHQAIAEVEVTSAQPLNAT
QIEKIAAAMEKRLARKVKLNCNVDNALIAGVIVRTEDFVIDGSSRGQLTRLANELQL