HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P43709

Names and origin
Entry : P43709 (reviewed)
Entry name : ACP_HAEIN
Protein names : Acyl carrier protein (ACP)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : acpP
ORF names : HI_0154
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ACP phosphopantetheine attachment site binding involved in fatty acid biosynthetic process; cytoplasm
GO identifier : GO:0000036; GO:0005737
Keywords
Ligand & Biological process : Complete proteome; Cytoplasm; Fatty acid biosynthesis; Fatty acid metabolism; Lipid biosynthesis; Lipid metabolism; Phosphopantetheine; Reference proteome
General annotation
Domains : Acyl carrier domain (1)
Pathway : Lipid metabolism; fatty acid biosynthesis.
Subcellular location : Cytoplasm.
Reference
PubMed ID : 7542800
Protein sequence
Length : 84 residues
>P43709|ACP_HAEIN Haemophilus influenzae Rd KW20
MSIEERVKKIIVEQLGVKEEDVKPEASFVEDLGADSLDTVELVMALEEEFDIEIPDEEAE
KITTVQSAIDYVQNNQ