HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P43013

Names and origin
Entry : P43013 (reviewed)
Entry name : AZOR_HAEIN
Protein names : FMN-dependent NADH-azoreductase (EC 1.7.-.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : azoR
ORF names : HI_1366
EC number : 1.7.-.-
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : FMN binding; FMN reductase activity; electron carrier activity; oxidoreductase activity, acting on NAD(P)H, NAD(P) as acceptor; oxidoreductase activity, acting on other nitrogenous compounds as donors
GO identifier : GO:0010181; GO:0008752; GO:0009055; GO:0016652; GO:0016661
Keywords
Ligand & Biological process : Complete proteome; FMN; Flavoprotein; NAD; Oxidoreductase; Reference proteome
General annotation
Sequence similarities : Belongs to Azoreductase type 1 family
Reference
PubMed ID : 8635745; 7542800
Protein sequence
Length : 210 residues
>P43013|AZOR_HAEIN Haemophilus influenzae Rd KW20
MSNVLVLKSSISGNNSQTNQLADYVIEKLQGNNIVVRDLSQQPLPYFDTAAAIAVRGEPK
TTEEKQLLALSDKLIEELKNAQTLIIGAPMYNLNVPTQLKSYFDFIARPRVTFQYTANGS
EGLLKGKKAILLCAFGGLYDEENLVTQYMKSILGFIGITDVQFVYAQGIGFGPEAIEKAQ
ASAKNKINEIVAAL