HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P43009

Names and origin
Entry : P43009 (reviewed)
Entry name : EXBD_HAEIN
Protein names : Biopolymer transport protein ExbD
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : exbD
ORF names : HI_0252
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; plasma membrane; protein transport; transporter activity
GO identifier : GO:0016021; GO:0005886; GO:0015031; GO:0005215
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane; Protein transport; Reference proteome; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to ExbD/TolR family
Subcellular location : Cell inner membrane; Single-pass type II membrane protein.
Reference
PubMed ID : 7828935; 7542800
Protein sequence
Length : 159 residues
>P43009|EXBD_HAEIN Haemophilus influenzae Rd KW20
MKKFDEINIIPFIDIMLVLLTVVLITASFISQGKIQVNVPKASTAVAFKSDELAKLLTVT
ADKQLYFNDKPISQEALEAEIAQWNKDQKVTLKIDAEASFQDFVTITDMLSKNEIKNVAI
VSMKDKGKSAGKNSQESTPSQSVPTTP