HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P43008

Names and origin
Entry : P43008 (reviewed)
Entry name : EXBB_HAEIN
Protein names : Biopolymer transport protein ExbB
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : exbB
ORF names : HI_0253
History
Date of creation : 1995-11-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; plasma membrane; protein transporter activity
GO identifier : GO:0016021; GO:0005886; GO:0008565
Keywords
Ligand & Biological process : Cell inner membrane; Cell membrane; Complete proteome; Membrane; Protein transport; Reference proteome; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to ExbB/TolQ family
Subcellular location : Cell inner membrane; Multi-pass membrane protein.
Reference
PubMed ID : 7828935; 7542800
Protein sequence
Length : 162 residues
>P43008|EXBB_HAEIN Haemophilus influenzae Rd KW20
MVQLFDFLQQYSDYFIIGLLLLMSIIMLAMVIERYLFLRKVSVAHYSTIHALDIDLNRNM
TVISTIGANAPYVGLLGTVIGILLTFYQIGHGGGDIDPSVIMLHLSLALKATALGILVAI
PSMVFYNGLGRKVEVNRLKWKVLSEQKDKE