HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P29281

Names and origin
Entry : P29281 (reviewed)
Entry name : CRP_HAEIN
Protein names : cAMP-activated global transcriptional regulator CRP (Catabolite activator protein) (CAP) (cAMP receptor protein) (CRP) (cAMP regulatory protein)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : crp
ORF names : cap
History
Date of creation : 1992-12-01
Date of modification : 2013-11-13
Date of sequence modification : 1992-12-01
Protein attributes
Protein existence : Evidence at protein level
Gene Ontology (GO)
GO term name : DNA binding; cAMP binding; establishment of competence for transformation; intracellular; sequence-specific DNA binding transcription factor activity; transcription, DNA-dependent
GO identifier : GO:0003677; GO:0030552; GO:0030420; GO:0005622; GO:0003700; GO:0006351
Keywords
Ligand & Biological process : Acetylation; Activator; Competence; Complete proteome; DNA-binding; Nucleotide-binding; Reference proteome; Transcription; Transcription regulation; cAMP; cAMP-binding
General annotation
Domains : Cyclic nucleotide-binding domain (1); HTH crp-type DNA-binding domain (1)
Reference
PubMed ID : 1542653; 7542800; 8226661; 15769466; 18761017
Protein sequence
Length : 240 residues
>P29281|CRP_HAEIN Haemophilus influenzae Rd KW20
MSNELTEIDEVVTSSQEEATQRDPVLDWFLTHCHLHKYPAKSTLIHAGEDATTLYYVIKG
SVMVSSKDDEGKEMILTYLGAGQFFGEAGLFDEGSKRSAWVKTKTTCEIAEISYKKYRQL
IQANPEILMFLTAQLARRLQNTSRQVTNLAFLDVAGRIAQTLMNLAKQPEAMTHPDGMQI
KITRQEIGQMVGCSRETVGRIIKMLEDQNLIHAHGKTIVVYGAR