HIGDB - Haemophilus influenzae Genome Database

Protein search results for - P29280

Names and origin
Entry : P29280 (reviewed)
Entry name : SLMA_HAEIN
Protein names : Nucleoid occlusion factor SlmA
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : slmA
ORF names : HI_0955
History
Date of creation : 1992-12-01
Date of modification : 2013-11-13
Date of sequence modification : 1995-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : bacterial nucleoid; cell cycle; cell division; cytoplasm; negative regulation of barrier septum assembly; sequence-specific DNA binding
GO identifier : GO:0043590; GO:0007049; GO:0051301; GO:0005737; GO:0010974; GO:0043565
Keywords
Ligand & Biological process : Cell cycle; Cell division; Complete proteome; Cytoplasm; DNA-binding; Reference proteome
General annotation
Domains : HTH tetR-type DNA-binding domain (1)
Sequence similarities : Belongs to Nucleoid occlusion factor SlmA family
Subcellular location : Cytoplasm › nucleoid.
Reference
PubMed ID : 7542800; 1542653
Protein sequence
Length : 234 residues
>P29280|SLMA_HAEIN Haemophilus influenzae Rd KW20
MVEEQLSLSGVEEIAPKIETPKIEKRTVKERRQQVLTVLIHMLHSERGMERMTTARLAKE
VGVSEAALYRYFPSKTKMFEALIEHIESTLLSRITASMRNETQTMNRIHDILQTILDFAR
KNPGLTRVLTGHALMFEEAQLQARVAQFFDRLEMQFVNILQMRKLREGRAFNVDERIIAS
HLVTLCEGQFMRYVRTNFRLNSSQSFEQQWRFIEPLFA