HIGDB - Haemophilus influenzae Genome Database

Protein search results for - O86230

Names and origin
Entry : O86230 (reviewed)
Entry name : Y976A_HAEIN
Protein names : Uncharacterized transporter HI_0976.1
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_0976.1
History
Date of creation : 1999-07-15
Date of modification : 2013-11-13
Date of sequence modification : 1998-11-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; plasma membrane; transport
GO identifier : GO:0016021; GO:0005886; GO:0006810
Keywords
Ligand & Biological process : Cell membrane; Complete proteome; Membrane; Reference proteome; Transmembrane; Transmembrane helix; Transport
General annotation
Domains : EamA domain (1)
Sequence similarities : Belongs to EamA transporter family
Subcellular location : Cell membrane; Multi-pass membrane protein.
Reference
PubMed ID : 7542800;
Protein sequence
Length : 182 residues
>O86230|Y976A_HAEIN Haemophilus influenzae Rd KW20
MAFIGVAILINGGKNNEGIDNISLFGCLLVLSAGIIFAAVLRWTQRVVAKVSTQAYTSVS
IVLGTITTLPFTLLLTENWQISLNSTGIAGLLYLAIGCSWLAYWLWNKGLNSVDANISGV
LVALEPLFGILFAVSLLGETLSFSAALGITIIMLATLGSTLLPKLLKKSV