HIGDB - Haemophilus influenzae Genome Database

Protein search results for - O86226

Names and origin
Entry : O86226 (reviewed)
Entry name : Y559A_HAEIN
Protein names : Uncharacterized protein HI_0559.1
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_0559.1
History
Date of creation : 2000-05-30
Date of modification : 2013-11-13
Date of sequence modification : 1998-11-01
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : integral to membrane; plasma membrane
GO identifier : GO:0016021; GO:0005886
Keywords
Ligand & Biological process : Cell membrane; Complete proteome; Membrane; Reference proteome; Transmembrane; Transmembrane helix
General annotation
Subcellular location : Cell membrane; Multi-pass membrane protein.
Reference
PubMed ID : 7542800;
Protein sequence
Length : 123 residues
>O86226|Y559A_HAEIN Haemophilus influenzae Rd KW20
MKSYLKTLIFFPLILQIVVTALLIWFDDDSSGVIVPFSSYALTAFLLAAIPAFLTALLAA
KFRYTRYNIASIVLVSSIISFVYCNMASYFYLLLLGEQDTSFWGWLTEGGLSLGL