HIGDB - Haemophilus influenzae Genome Database

Protein search results for - O52391

Names and origin
Entry : O52391 (unreviewed)
Entry name : O52391_HAEIN
Protein names : Mutant excinuclease (Fragment)
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
Gene names : uvrA
History
Date of creation : 1998-06-01
Date of modification : 2013-05-29
Date of sequence modification : 1998-06-01
Protein attributes
Protein existence : Predicted
Sequence status : fragment
Gene Ontology (GO)
GO term name : ATP binding; ATP catabolic process; ATPase activity
GO identifier : GO:0005524; GO:0006200; GO:0016887
Protein sequence
Length : 118 residues
>O52391|O52391_HAEIN Haemophilus influenzae Rd KW20
DMTVEEAREFFDAIPMIARKLQTLMDVGLSYIRLGQSSTTLSGGEAQRVKLATELSKRDT
GKTLYILDEPTTGLHFADIKQLLEVLHRLRDQGNTIVVIEHNLDVIKTAD