HIGDB - Haemophilus influenzae Genome Database

Protein search results for - O05023

Names and origin
Entry : O05023 (reviewed)
Entry name : Y493_HAEIN
Protein names : Uncharacterized transposase-like protein HI_0493
Organism : Haemophilus influenzae Rd KW20
Organism ID : 71421
ORF names : HI_0493
History
Date of creation : 1998-12-15
Date of modification : 2013-11-13
Date of sequence modification : 1997-07-01
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; DNA recombination; transposition
GO identifier : GO:0003677; GO:0006310; GO:0032196
Keywords
Ligand & Biological process : Complete proteome; DNA recombination; DNA-binding; Reference proteome; Transposable element; Transposition
General annotation
Sequence similarities : Belongs to Transposase IS3/IS150/IS904 family
Reference
PubMed ID : 7542800
Protein sequence
Length : 126 residues
>O05023|Y493_HAEIN Haemophilus influenzae Rd KW20
MRGRTRIGKFTTCGERNPKKVARTQPTKKDLKTQNPILHSDQGWLYQMVGYQAILRENSI
QQNMSRKGNYLDNNAMENFFGRLKTECYYDKRFETFKQLKKQLMSIFIITTMITFRGN