HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7AIE7

Names and origin
Entry : E7AIE7 (unreviewed)
Entry name : E7AIE7_HAEIF
Protein names : Ribosomal silencing factor RsfS
Organism : Haemophilus influenzae F3047
Organism ID : 935897
Gene names : rsfS
ORF names : HICON_03190
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; mature ribosome assembly; negative regulation of ribosome biogenesis; negative regulation of translation
GO identifier : GO:0005737; GO:0042256; GO:0090071; GO:0017148
Keywords
Ligand & Biological process : Cytoplasm; Repressor; Translation regulation
General annotation
Sequence similarities : Belongs to Iojap/RsfS family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 22377449
Protein sequence
Length : 110 residues
>E7AIE7|E7AIE7_HAEIF Haemophilus influenzae F3047
MALVEFLMETLDGLKGTDIVHFDVRGKSSITDNMIICTGTSSRQVSAMADNLITECKKAG
FETFGEEGKNTADWIVVDLGQAIVHIMQPDAREMYQLEKLWA