HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7AID7

Names and origin
Entry : E7AID7 (unreviewed)
Entry name : E7AID7_HAEIF
Protein names : Citrate lyase acyl carrier protein (Citrate lyase gamma chain)
Organism : Haemophilus influenzae F3047
Organism ID : 935897
Gene names : citD
ORF names : HICON_03090
History
Date of creation : 2011-03-08
Date of modification : 2013-04-03
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; lyase activity
GO identifier : GO:0005737; GO:0016829
Keywords
Ligand & Biological process : Cytoplasm; Lyase; Phosphoprotein
General annotation
Sequence similarities : Belongs to CitD family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 22377449
Protein sequence
Length : 103 residues
>E7AID7|E7AID7_HAEIF Haemophilus influenzae F3047
MKITKVAVAGTLESSDVQVRVQPFDSLDIEINSSVAKQFGEQIEATVREVLAKLGITAAQ
VIVEDKGALDCVLQARVKAAAMRATDEAINWEAVL