HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7AI87

Names and origin
Entry : E7AI87 (unreviewed)
Entry name : E7AI87_HAEIF
Protein names : Mercuric ion scavenger protein
Organism : Haemophilus influenzae F3047
Organism ID : 935897
ORF names : HICON_02330
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : metal ion binding; metal ion transport
GO identifier : GO:0046872; GO:0030001
Reference
PubMed ID : 22377449
Protein sequence
Length : 100 residues
>E7AI87|E7AI87_HAEIF Haemophilus influenzae F3047
MKKLCTALLLSLFAISFAHANETKQIVLKVKEMNCQLCAYLVNKELRNINGVISTKASIK
DGLVTVVEDPKVTNQQLFDAIHKLKYTAEVVN