HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7AHY5

Names and origin
Entry : E7AHY5 (unreviewed)
Entry name : E7AHY5_HAEIF
Protein names : Glutaredoxin
Organism : Haemophilus influenzae F3047
Organism ID : 935897
ORF names : HICON_01290
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cell redox homeostasis; electron carrier activity; protein disulfide oxidoreductase activity
GO identifier : GO:0045454; GO:0009055; GO:0015035
General annotation
Sequence similarities : Belongs to Glutaredoxin family, Monothiol subfamily
Reference
PubMed ID : 22377449
Protein sequence
Length : 128 residues
>E7AHY5|E7AHY5_HAEIF Haemophilus influenzae F3047
MIKCLPRLFIGNIMETLDKIKKQISENPILIYMKGSPKLPSCGFSARASEALMHCKVPFG
YVDILQHPDIRAELPTYANWPTFPQLWVEGELIGGCDIILEMYQAGELQTLLAEVAAKHA