HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7AHU4

Names and origin
Entry : E7AHU4 (unreviewed)
Entry name : E7AHU4_HAEIF
Protein names : Arginine repressor
Organism : Haemophilus influenzae F3047
Organism ID : 935897
Gene names : argR
ORF names : HICON_00880
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; arginine binding; arginine biosynthetic process; cytoplasm; protein oligomerization; sequence-specific DNA binding transcription factor activity; transcription, DNA-dependent
GO identifier : GO:0003677; GO:0034618; GO:0006526; GO:0005737; GO:0051259; GO:0003700; GO:0006351
Keywords
Ligand & Biological process : Amino-acid biosynthesis; Arginine biosynthesis; Cytoplasm; DNA-binding; Repressor; Transcription; Transcription regulation
General annotation
Pathway : Amino-acid biosynthesis; L-arginine biosynthesis [regulation].
Sequence similarities : Belongs to ArgR family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 22377449
Protein sequence
Length : 159 residues
>E7AHU4|E7AHU4_HAEIF Haemophilus influenzae F3047
MTENLTRAFKELLNQERFGSQSEIVDALKKQGFTGINQSKISRMLSKFGAVRTRNTKMEM
VYCLPNELSVPNTSSPLKNLVLDVDHNAMLIIIKTTPGAAQLIARLLDSIGKSEGILGTI
AGDDTIFVTPTNDKPIDELLQNIQRLF