HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7AHS0

Names and origin
Entry : E7AHS0 (unreviewed)
Entry name : E7AHS0_HAEIF
Protein names : 50S ribosomal protein L25
Organism : Haemophilus influenzae F3047
Organism ID : 935897
Gene names : rplY
ORF names : HICON_00640
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : 5S rRNA binding; ribosome; structural constituent of ribosome; translation
GO identifier : GO:0008097; GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein L25P family
Reference
PubMed ID : 22377449
Protein sequence
Length : 103 residues
>E7AHS0|E7AHS0_HAEIF Haemophilus influenzae F3047
MAFKFNAEVRTTQGKGASRRLRNNGQIPAIVYGGSEEPVSIILNHDELNNAQAHESFYSE
VITLVIGGKEVAVKVQAMQRHPFKPKLVHIDFKRA