HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7AH66

Names and origin
Entry : E7AH66 (unreviewed)
Entry name : E7AH66_HAEIF
Protein names : Uncharacterized protein
Organism : Haemophilus influenzae F3047
Organism ID : 935897
ORF names : HICON_17110
History
Date of creation : 2011-03-08
Date of modification : 2013-04-03
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Predicted
Reference
PubMed ID : 22377449
Protein sequence
Length : 59 residues
>E7AH66|E7AH66_HAEIF Haemophilus influenzae F3047
MLHCDEIFIYDNSGIAPELIFQLKDNCITQFSEFLPSWREKILNNLRKLGFEKIF