HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7AH47

Names and origin
Entry : E7AH47 (unreviewed)
Entry name : E7AH47_HAEIF
Protein names : Cold shock protein homolog
Organism : Haemophilus influenzae F3047
Organism ID : 935897
ORF names : HICON_17300
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA binding; cytoplasm; regulation of transcription, DNA-dependent; response to stress
GO identifier : GO:0003677; GO:0005737; GO:0006355; GO:0006950
Keywords
Ligand & Biological process : Cytoplasm
General annotation
Subcellular location : Cytoplasm.
Reference
PubMed ID : 22377449
Protein sequence
Length : 80 residues
>E7AH47|E7AH47_HAEIF Haemophilus influenzae F3047
MEIGIVKWFNNAKGFGFISAEGVDADIFAHYSVIEMDGYRSLKAGQKVQFEVLHGDKGSH
ATKIIPIADTQE