HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7AH46

Names and origin
Entry : E7AH46 (unreviewed)
Entry name : E7AH46_HAEIF
Protein names : UPF0181 protein HICON_17310
Organism : Haemophilus influenzae F3047
Organism ID : 935897
ORF names : HICON_17310
History
Date of creation : 2011-03-08
Date of modification : 2013-04-03
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
General annotation
Sequence similarities : Belongs to UPF0181 family
Reference
PubMed ID : 22377449
Protein sequence
Length : 56 residues
>E7AH46|E7AH46_HAEIF Haemophilus influenzae F3047
MFDINLTHEQQQKAVEQIQELMAKGISSGEAIQIVAKALREIHKNDKKTPEN