HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7AGZ4

Names and origin
Entry : E7AGZ4 (unreviewed)
Entry name : E7AGZ4_HAEIF
Protein names : Predicted 2Fe-2S cluster-containing protein
Organism : Haemophilus influenzae F3047
Organism ID : 935897
ORF names : HICON_17830
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : 2 iron, 2 sulfur cluster binding; electron carrier activity; metal ion binding
GO identifier : GO:0051537; GO:0009055; GO:0046872
Keywords
Ligand & Biological process : 2Fe-2S; Iron; Iron-sulfur; Metal-binding
General annotation
Domains : 2Fe-2S ferredoxin-type domain (1)
Reference
PubMed ID : 22377449
Protein sequence
Length : 90 residues
>E7AGZ4|E7AGZ4_HAEIF Haemophilus influenzae F3047
MKIHLIYSKTTLEFNNETSLLDHLKKNNIHHEYQCRSGYCGSCRVKIKKGKVSYKEMPLA
FIQPDEILLCCCHVESDLEIDL