HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7AGT8

Names and origin
Entry : E7AGT8 (unreviewed)
Entry name : E7AGT8_HAEIF
Protein names : Uncharacterized protein
Organism : Haemophilus influenzae F3047
Organism ID : 935897
ORF names : HICON_15500
History
Date of creation : 2011-03-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : hydrolase activity, acting on ester bonds; mRNA binding
GO identifier : GO:0016788; GO:0003729
Reference
PubMed ID : 22377449
Protein sequence
Length : 92 residues
>E7AGT8|E7AGT8_HAEIF Haemophilus influenzae F3047
MSNADKLLQKLKKEPPPRDFTWDELKVLLCSIGFEPKQGNGSRVKFIHPDLSYPISLHRP
HPGNELKRYVIEQVKDALDELSLG