HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7AGI5

Names and origin
Entry : E7AGI5 (unreviewed)
Entry name : E7AGI5_HAEIF
Protein names : UPF0102 protein HICON_14450
Organism : Haemophilus influenzae F3047
Organism ID : 935897
ORF names : HICON_14450
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : nuclease activity; nucleic acid binding; nucleic acid phosphodiester bond hydrolysis
GO identifier : GO:0004518; GO:0003676; GO:0090305
General annotation
Sequence similarities : Belongs to UPF0102 family
Reference
PubMed ID : 22377449
Protein sequence
Length : 127 residues
>E7AGI5|E7AGI5_HAEIF Haemophilus influenzae F3047
MFSLKRQQGASFEHQARLFLESKGLTFIAANQNFKCGELDLIMNDKETIVFVEVRQRSHS
AYGSAIESVDWRKQQKWLDAANLWLAKQNMSLEDANCRFDLIAFGKTPQDIQWIPNFLD