HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7AGB7

Names and origin
Entry : E7AGB7 (unreviewed)
Entry name : E7AGB7_HAEIF
Protein names : Phosphocarrier protein HPr
Organism : Haemophilus influenzae F3047
Organism ID : 935897
ORF names : HICON_13760
History
Date of creation : 2011-03-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; phosphoenolpyruvate-dependent sugar phosphotransferase system; protein serine/threonine kinase activity; sugar:hydrogen symporter activity
GO identifier : GO:0005737; GO:0009401; GO:0004674; GO:0005351
Keywords
Ligand & Biological process : Cytoplasm; Kinase; Phosphotransferase system; Serine/threonine-protein kinase; Transferase
General annotation
Subcellular location : Cytoplasm.
Reference
PubMed ID : 22377449
Protein sequence
Length : 93 residues
>E7AGB7|E7AGB7_HAEIF Haemophilus influenzae F3047
MYSKDVEIIAPNGLHTRPAAQFVKEAKAFSSEITVTSGGKSASAKSLFKLQTLALTQGTT
LTISADGEDEQQAVEHLVALIPTLE