HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7AG61

Names and origin
Entry : E7AG61 (unreviewed)
Entry name : E7AG61_HAEIF
Protein names : Acyl carrier protein (ACP)
Organism : Haemophilus influenzae F3047
Organism ID : 935897
Gene names : acpP
ORF names : HICON_13190
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ACP phosphopantetheine attachment site binding involved in fatty acid biosynthetic process; cytoplasm
GO identifier : GO:0000036; GO:0005737
Keywords
Ligand & Biological process : Cytoplasm; Fatty acid biosynthesis; Fatty acid metabolism; Lipid biosynthesis; Lipid metabolism; Phosphopantetheine
General annotation
Domains : Acyl carrier domain (1)
Pathway : Lipid metabolism; fatty acid biosynthesis.
Subcellular location : Cytoplasm.
Reference
PubMed ID : 22377449
Protein sequence
Length : 84 residues
>E7AG61|E7AG61_HAEIF Haemophilus influenzae F3047
MSIEERVKKIIVEQLGVKEEDVKPEASFVEDLGADSLDTVELVMALEEEFDIEIPDEEAE
KITTVQSAIDYVQNNQ