HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7AG31

Names and origin
Entry : E7AG31 (unreviewed)
Entry name : E7AG31_HAEIF
Protein names : Sec-independent protein translocase protein TatA
Organism : Haemophilus influenzae F3047
Organism ID : 935897
Gene names : tatA
ORF names : HICON_12890
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : TAT protein transport complex; integral to plasma membrane; protein secretion; protein transmembrane transporter activity; protein transport by the Tat complex
GO identifier : GO:0033281; GO:0005887; GO:0009306; GO:0008320; GO:0043953
Keywords
Ligand & Biological process : Cell membrane; Membrane; Protein transport; Translocation; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to TatA/E family
Subcellular location : Cell membrane; Single-pass membrane protein.
Reference
PubMed ID : 22377449
Protein sequence
Length : 83 residues
>E7AG31|E7AG31_HAEIF Haemophilus influenzae F3047
MFGLSPAQLIILLVVILLIFGTKKLRNAGSDLGAAVKGFKKAMKEDEKVKDAEFKSIDNE
TASAKKENIKEKEQA