HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7AFR3

Names and origin
Entry : E7AFR3 (unreviewed)
Entry name : E7AFR3_HAEIF
Protein names : Putative Holliday junction resolvase (EC 3.1.-.-)
Organism : Haemophilus influenzae F3047
Organism ID : 935897
ORF names : HICON_11700
EC number : 3.1.-.-
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA recombination; DNA repair; cytoplasm; nuclease activity; nucleic acid binding; nucleic acid phosphodiester bond hydrolysis
GO identifier : GO:0006310; GO:0006281; GO:0005737; GO:0004518; GO:0003676; GO:0090305
Keywords
Ligand & Biological process : Cytoplasm; DNA damage; DNA recombination; DNA repair; Hydrolase; Nuclease
General annotation
Sequence similarities : Belongs to YqgF HJR family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 22377449
Protein sequence
Length : 151 residues
>E7AFR3|E7AFR3_HAEIF Haemophilus influenzae F3047
MGITALAFDFGTKSIGCAIGQSITGTAQALPAFKAQDGIPNWEAIEKCLKEWKPDVVIVG
LPLNMDGTEQDLTLRARKFANRLQGRFGVNVHLQDERLTTTQARSEIFERGGFKALKKGK
IDGVSACLILESWFEYAEY