HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7AF28

Names and origin
Entry : E7AF28 (unreviewed)
Entry name : E7AF28_HAEIF
Protein names : ATP synthase subunit delta (ATP synthase F(1) sector subunit delta) (F-type ATPase subunit delta)
Organism : Haemophilus influenzae F3047
Organism ID : 935897
Gene names : atpH
ORF names : HICON_09330
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : plasma membrane; plasma membrane ATP synthesis coupled proton transport; proton-transporting ATP synthase activity, rotational mechanism; proton-transporting ATP synthase complex, catalytic core F(1)
GO identifier : GO:0005886; GO:0042777; GO:0046933; GO:0045261
Keywords
Ligand & Biological process : ATP synthesis; CF(1); Cell membrane; Hydrogen ion transport; Ion transport; Membrane; Transport
General annotation
Sequence similarities : Belongs to ATPase delta chain family
Subcellular location : Cell membrane; Peripheral membrane protein.
Reference
PubMed ID : 22377449
Protein sequence
Length : 189 residues
>E7AF28|E7AF28_HAEIF Haemophilus influenzae F3047
MSELTTIARPYAKAAFDFAIEQSAVEKWTEMLGFAAAVAEDETVKAYLSSSLSAQKLADT
VISICGEQLDQYGQNLIRLMAENKRLSAIPAVFEEFKHHVEEHQAIAEVEVTSAQPLNAT
QIEKIAAAMEKRLARKVKLNCNVDNALIAGVIVRTEDFVIDGSSRGQLTRLANELQL