HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7AER3

Names and origin
Entry : E7AER3 (unreviewed)
Entry name : E7AER3_HAEIF
Protein names : Cell division protein FtsB
Organism : Haemophilus influenzae F3047
Organism ID : 935897
Gene names : ftsB
ORF names : HICON_08160
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cell division site; cytokinesis by binary fission; integral to plasma membrane
GO identifier : GO:0032153; GO:0043093; GO:0005887
Keywords
Ligand & Biological process : Cell cycle; Cell division; Cell inner membrane; Cell membrane; Coiled coil; Membrane; Transmembrane; Transmembrane helix
General annotation
Sequence similarities : Belongs to FtsB family
Subcellular location : Cell inner membrane; Single-pass type II membrane protein.
Reference
PubMed ID : 22377449
Protein sequence
Length : 100 residues
>E7AER3|E7AER3_HAEIF Haemophilus influenzae F3047
MRLLILILLSVLVLFQYNFWFGSNGFLDYRQNAEKIKENQAENEKLSQRNQRINAEIQGL
TKGFEAIEERARMQHGLVKENEVFYHIVKESK