HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7AEN0

Names and origin
Entry : E7AEN0 (unreviewed)
Entry name : E7AEN0_HAEIF
Protein names : Protein translocase subunit SecE
Organism : Haemophilus influenzae F3047
Organism ID : 935897
Gene names : secE
ORF names : HICON_07820
History
Date of creation : 2011-03-08
Date of modification : 2013-11-13
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : P-P-bond-hydrolysis-driven protein transmembrane transporter activity; integral to membrane; intracellular protein transmembrane transport; plasma membrane; protein secretion; protein targeting; protein transport by the Sec complex
GO identifier : GO:0015450; GO:0016021; GO:0065002; GO:0005886; GO:0009306; GO:0006605; GO:0043952
Keywords
Ligand & Biological process : Cell membrane; Membrane; Protein transport; Translocation; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to SecE/SEC61-gamma family
Subcellular location : Cell membrane; Multi-pass membrane protein.
Reference
PubMed ID : 22377449
Protein sequence
Length : 150 residues
>E7AEN0|E7AEN0_HAEIF Haemophilus influenzae F3047
MATEIVDKKKNTQEVIVEGKSKGLNTFLWVLVVIFFAAAAIGNIYFQQIYSLPIRVIGMA
IALVIAFILAAITNQGTKARAFFNDSRTEARKVVWPTRAEARQTTLIVIGVTMIASLFFW
AVDSIIVTVINFLTDLRF