HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7AEM5

Names and origin
Entry : E7AEM5 (unreviewed)
Entry name : E7AEM5_HAEIF
Protein names : Sulfurtransferase TusA homolog (EC 2.8.1.-)
Organism : Haemophilus influenzae F3047
Organism ID : 935897
Gene names : tusA
ORF names : HICON_07780
EC number : 2.8.1.-
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; sulfurtransferase activity
GO identifier : GO:0005737; GO:0016783
Keywords
Ligand & Biological process : Cytoplasm; Transferase
General annotation
Sequence similarities : Belongs to UPF0033 family, TusA subfamily
Subcellular location : Cytoplasm.
Reference
PubMed ID : 22377449
Protein sequence
Length : 87 residues
>E7AEM5|E7AEM5_HAEIF Haemophilus influenzae F3047
MSEISVTQTLNTLGLRCPEPVMLVRKNIRHLNDGEILLIIADDPATTRDIPSFCQFMDHT
LLQCEVEKPPFKYWVKRGK