HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7AEL8

Names and origin
Entry : E7AEL8 (unreviewed)
Entry name : E7AEL8_HAEIF
Protein names : Large-conductance mechanosensitive channel
Organism : Haemophilus influenzae F3047
Organism ID : 935897
Gene names : mscL
ORF names : HICON_07710
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : integral to membrane; ion channel activity; plasma membrane
GO identifier : GO:0016021; GO:0005216; GO:0005886
Keywords
Ligand & Biological process : Cell membrane; Ion channel; Ion transport; Membrane; Transmembrane; Transmembrane helix; Transport
General annotation
Sequence similarities : Belongs to MscL family
Subcellular location : Cell membrane; Multi-pass membrane protein.
Reference
PubMed ID : 22377449
Protein sequence
Length : 140 residues
>E7AEL8|E7AEL8_HAEIF Haemophilus influenzae F3047
MNFIKEFREFAMRGNVVDMAVGVIIGGAFGKIVSSLVSDIFMPVLGILTGGIDFKDMKFV
LAQAQGDVPAVTLNYGVFIQNVIDFIIIAFAIFMMIKGLNKVRKPEEKKAGPTSEDLLTE
IRDLLKNK