HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7AEB7

Names and origin
Entry : E7AEB7 (unreviewed)
Entry name : E7AEB7_HAEIF
Protein names : Protein CyaY
Organism : Haemophilus influenzae F3047
Organism ID : 935897
Gene names : cyaY
ORF names : HICON_06690
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ferric iron binding; iron-sulfur cluster assembly
GO identifier : GO:0008199; GO:0016226
General annotation
Sequence similarities : Belongs to Frataxin family
Reference
PubMed ID : 22377449
Protein sequence
Length : 109 residues
>E7AEB7|E7AEB7_HAEIF Haemophilus influenzae F3047
MNIAEFHQNIEQVWQKIEEELENQGADVDCETQGSVFTITFDNRTQIVINKQEPLLELWI
ASKLGGFHFAFKNGDWVSNDGQRFWDCFVEACAAHGENVQF