HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7AE54

Names and origin
Entry : E7AE54 (unreviewed)
Entry name : E7AE54_HAEIF
Protein names : 30S ribosomal protein S13
Organism : Haemophilus influenzae F3047
Organism ID : 935897
Gene names : rpsM
ORF names : HICON_06050
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : rRNA binding; ribosome; structural constituent of ribosome; tRNA binding; translation
GO identifier : GO:0019843; GO:0005840; GO:0003735; GO:0000049; GO:0006412
Keywords
Ligand & Biological process : RNA-binding; Ribonucleoprotein; Ribosomal protein; rRNA-binding; tRNA-binding
General annotation
Sequence similarities : Belongs to Ribosomal protein S13P family
Reference
PubMed ID : 22377449
Protein sequence
Length : 126 residues
>E7AE54|E7AE54_HAEIF Haemophilus influenzae F3047
MARIAGINIPDHKHAVIALTAIYGIGKTRSQAICAAAGIAEDVKIRELSEEQIDKLRDEV
GKFTVEGDLRREVTLNIKRLLDLGCYRGLRHRRSLPVRGQRTKTNARTRKGPRKPIKK