HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7AE19

Names and origin
Entry : E7AE19 (unreviewed)
Entry name : E7AE19_HAEIF
Protein names : Uncharacterized protein
Organism : Haemophilus influenzae F3047
Organism ID : 935897
ORF names : HICON_05670
History
Date of creation : 2011-03-08
Date of modification : 2013-04-03
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Predicted
Reference
PubMed ID : 22377449
Protein sequence
Length : 51 residues
>E7AE19|E7AE19_HAEIF Haemophilus influenzae F3047
MMSLVITVPNFDLRIYSPLKEANIVNYQKEILGGLSMNIKLPLWITH