HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7AE17

Names and origin
Entry : E7AE17 (unreviewed)
Entry name : E7AE17_HAEIF
Protein names : Outer membrane protein assembly factor BamE
Organism : Haemophilus influenzae F3047
Organism ID : 935897
Gene names : bamE
ORF names : HICON_05650
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : Gram-negative-bacterium-type cell outer membrane assembly; cell outer membrane; plasma membrane; protein insertion into membrane
GO identifier : GO:0043165; GO:0009279; GO:0005886; GO:0051205
Keywords
Ligand & Biological process : Cell membrane; Cell outer membrane; Lipoprotein; Membrane; Palmitate; Signal
General annotation
Sequence similarities : Belongs to BamE family
Subcellular location : Cell outer membrane; Lipid-anchor.
Reference
PubMed ID : 22377449
Protein sequence
Length : 149 residues
>E7AE17|E7AE17_HAEIF Haemophilus influenzae F3047
MQVKTLLGATFLALSLASCSTVEKVVYRIDVPQGNYLEATTVAQVKEGMTAQQVQYLLGT
PILIDPYNNYTWYYVFLQQRAYETPVQHTFTVKFDQRGIVTETHLDKPLPQVSQQGENNT
VIETGEKPKSSWWKFWK