HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7AE00

Names and origin
Entry : E7AE00 (unreviewed)
Entry name : E7AE00_HAEIF
Protein names : DNA-binding protein fis
Organism : Haemophilus influenzae F3047
Organism ID : 935897
Gene names : fis
ORF names : HICON_04200
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription, DNA-dependent
GO identifier : GO:0043565; GO:0003700; GO:0006351
Keywords
Ligand & Biological process : Activator; DNA-binding; Transcription; Transcription regulation
General annotation
Sequence similarities : Belongs to Transcriptional regulatory fis family
Reference
PubMed ID : 22377449
Protein sequence
Length : 107 residues
>E7AE00|E7AE00_HAEIF Haemophilus influenzae F3047
MLEQQRNSADALTVSVLNAQSQVTSKPLRDSVKQALRNYLAQLEGQDVNDLYELVLAEVE
HPMLDMIMQYTRGNQTRAANMLGINRGTLRKKLKKYGMG