HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7ADY1

Names and origin
Entry : E7ADY1 (unreviewed)
Entry name : E7ADY1_HAEIF
Protein names : Putative membrane protein insertion efficiency factor
Organism : Haemophilus influenzae F3047
Organism ID : 935897
ORF names : HICON_04010
History
Date of creation : 2011-03-08
Date of modification : 2013-04-03
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : plasma membrane
GO identifier : GO:0005886
Keywords
Ligand & Biological process : Cell membrane; Membrane
General annotation
Sequence similarities : Belongs to UPF0161 family
Subcellular location : Cell membrane; Peripheral membrane protein; Cytoplasmic side.
Reference
PubMed ID : 22377449
Protein sequence
Length : 94 residues
>E7ADY1|E7ADY1_HAEIF Haemophilus influenzae F3047
MAETHSLGTKILIKIIRLYQIMISPFIGARCRFVPTCSCYGIEALKTHGLLKGGWLTLKR
VLKCHPLNAGGFDPVPPKTNNNDEKK