HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7ADU7

Names and origin
Entry : E7ADU7 (unreviewed)
Entry name : E7ADU7_HAEIF
Protein names : Putative uncharacterised protein
Organism : Haemophilus influenzae F3047
Organism ID : 935897
ORF names : HICON_03670
History
Date of creation : 2011-03-08
Date of modification : 2013-04-03
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : gluconate transmembrane transporter activity; membrane
GO identifier : GO:0015128; GO:0016020
Reference
PubMed ID : 22377449
Protein sequence
Length : 114 residues
>E7ADU7|E7ADU7_HAEIF Haemophilus influenzae F3047
MSELLINDYTRKGFVDGLCVRLPTICIRPGKPNKAASSFVSSIIREPLHGETSICPVAEK
MAFSFIKFLGKKKEEWALAITGYVVSIPIVLPILLIFIKAILDLGK