HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7ADT7

Names and origin
Entry : E7ADT7 (unreviewed)
Entry name : E7ADT7_HAEIF
Protein names : Thioredoxin
Organism : Haemophilus influenzae F3047
Organism ID : 935897
ORF names : HICON_03570
History
Date of creation : 2011-03-08
Date of modification : 2013-12-11
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cell redox homeostasis; glycerol ether metabolic process; protein disulfide oxidoreductase activity
GO identifier : GO:0045454; GO:0006662; GO:0015035
General annotation
Domains : Thioredoxin domain (1)
Sequence similarities : Belongs to Thioredoxin family
Reference
PubMed ID : 22377449
Protein sequence
Length : 115 residues
>E7ADT7|E7ADT7_HAEIF Haemophilus influenzae F3047
MSEVLHINDADFESVVVNSDIPVLLDFWAPWCGPCKMIAPVLDELAPEFAGKVKIVKMNV
DDNQATPAQFGVRSIPTLLLIKNGQVVATQVGALAKTQLANFINQHI