HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7ADM1

Names and origin
Entry : E7ADM1 (unreviewed)
Entry name : E7ADM1_HAEIF
Protein names : DNA gyrase inhibitor YacG
Organism : Haemophilus influenzae F3047
Organism ID : 935897
Gene names : yacG
ORF names : HICON_05110
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : DNA topoisomerase (ATP-hydrolyzing) inhibitor activity; negative regulation of DNA topoisomerase (ATP-hydrolyzing) activity; regulation of transcription, DNA-dependent; zinc ion binding
GO identifier : GO:0008657; GO:2000372; GO:0006355; GO:0008270
Keywords
Ligand & Biological process : Metal-binding; Zinc
General annotation
Sequence similarities : Belongs to DNA gyrase inhibitor YacG family
Reference
PubMed ID : 22377449
Protein sequence
Length : 76 residues
>E7ADM1|E7ADM1_HAEIF Haemophilus influenzae F3047
MSDEMIEVPCPICQKSVPWINESTFRPFCSKRCQLIDLGEWVAEEKAIPSDTADFAMDPN
VSDGWSIK