HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7ADG7

Names and origin
Entry : E7ADG7 (unreviewed)
Entry name : E7ADG7_HAEIF
Protein names : Transcriptional repressor NrdR
Organism : Haemophilus influenzae F3047
Organism ID : 935897
Gene names : nrdR
ORF names : HICON_04570
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ATP binding; DNA binding; negative regulation of transcription, DNA-dependent; transcription, DNA-dependent; zinc ion binding
GO identifier : GO:0005524; GO:0003677; GO:0045892; GO:0006351; GO:0008270
Keywords
Ligand & Biological process : ATP-binding; DNA-binding; Metal-binding; Nucleotide-binding; Repressor; Transcription; Transcription regulation; Zinc; Zinc-finger
General annotation
Domains : ATP-cone domain (1)
Sequence similarities : Belongs to NrdR family
Reference
PubMed ID : 22377449
Protein sequence
Length : 161 residues
>E7ADG7|E7ADG7_HAEIF Haemophilus influenzae F3047
MHCPFCDTEETKVIDSRLVSDGYQVRRRRECGHCHERFTTFEMAELIIPKIIKTDGTREP
FNEDKLRNGIQHALEKRPVSADDVEKAINHIILQLRATGEREVPSKLVGKLAMNELKKLD
KVAYIRFASVYLSFDDIDQFTIEIEKLKD