HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7ADF8

Names and origin
Entry : E7ADF8 (unreviewed)
Entry name : E7ADF8_HAEIF
Protein names : 50S ribosomal protein L28
Organism : Haemophilus influenzae F3047
Organism ID : 935897
Gene names : rpmB
ORF names : HICON_04480
History
Date of creation : 2011-03-08
Date of modification : 2013-05-29
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ribosome; structural constituent of ribosome; translation
GO identifier : GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Ribonucleoprotein; Ribosomal protein
General annotation
Sequence similarities : Belongs to Ribosomal protein L28P family
Reference
PubMed ID : 22377449
Protein sequence
Length : 86 residues
>E7ADF8|E7ADF8_HAEIF Haemophilus influenzae F3047
MSRVCQVTGKRPAVGNNRSHAMNAARRRFLPNLHTHRFWVESENRFVTLRLTAKGMRIID
KKGIDAVLAEIRARGEKI