HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A8E1

Names and origin
Entry : E7A8E1 (unreviewed)
Entry name : E7A8E1_HAEIF
Protein names : Nitrogen regulatory protein P-II
Organism : Haemophilus influenzae F3031
Organism ID : 866630
ORF names : HIBPF_02870
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : enzyme regulator activity; regulation of catalytic activity; regulation of nitrogen utilization; regulation of transcription, DNA-dependent; transcription, DNA-dependent
GO identifier : GO:0030234; GO:0050790; GO:0006808; GO:0006355; GO:0006351
Keywords
Ligand & Biological process : Transcription; Transcription regulation
General annotation
Sequence similarities : Belongs to P(II) protein family
Reference
PubMed ID : 22377449
Protein sequence
Length : 120 residues
>E7A8E1|E7A8E1_HAEIF Haemophilus influenzae F3031
MKKIEAMIKPFKLDDVRESLSDIGISGMTITEVRGFGRQKGHTELYRGAEYMVDFLPKVK
LEVVVPDELVDQCIEAIIETAQTGKIGDGKIFVYNVERAIRIRTGEENEDAI