HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A896

Names and origin
Entry : E7A896 (unreviewed)
Entry name : E7A896_HAEIF
Protein names : Mercuric ion scavenger protein
Organism : Haemophilus influenzae F3031
Organism ID : 866630
ORF names : HIBPF_02332
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : metal ion binding; metal ion transport
GO identifier : GO:0046872; GO:0030001
Reference
PubMed ID : 22377449
Protein sequence
Length : 76 residues
>E7A896|E7A896_HAEIF Haemophilus influenzae F3031
MKTITLNIKGIHCGCCVKSLTQVLTELDGVQSADVQLEGKVNITFDENRVNIAQLIEVIE
DAGFDATE