HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A872

Names and origin
Entry : E7A872 (unreviewed)
Entry name : E7A872_HAEIF
Protein names : Glycerol-3-phosphate acyltransferase (Acyl-PO4 G3P acyltransferase) (Acyl-phosphate--glycerol-3-phosphate acyltransferase) (G3P acyltransferase) (Lysophosphatidic acid synthase)
Organism : Haemophilus influenzae F3031
Organism ID : 866630
Gene names : plsY
ORF names : HIBPF_02100
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : acyl-phosphate glycerol-3-phosphate acyltransferase activity; integral to membrane; phospholipid biosynthetic process; plasma membrane
GO identifier : GO:0043772; GO:0016021; GO:0008654; GO:0005886
Keywords
Ligand & Biological process : Cell membrane; Lipid biosynthesis; Lipid metabolism; Membrane; Phospholipid biosynthesis; Phospholipid metabolism; Transferase; Transmembrane; Transmembrane helix
General annotation
Pathway : Lipid metabolism; phospholipid metabolism.
Sequence similarities : Belongs to PlsY family
Subcellular location : Cell membrane; Multi-pass membrane protein.
Reference
PubMed ID : 22377449
Protein sequence
Length : 215 residues
>E7A872|E7A872_HAEIF Haemophilus influenzae F3031
MSLFALFYMLFAYLLGSVSSAILICRIAGLPDPRQNGSHNPGATNVLRIGNRKSALAVLI
FDMLKGMIPVWAGYYLGLTQFELGMVALGACLGHIFPIFFQFKGGKGVATAFGAIAPISW
AVAGSMFGTWIFVFLVSGYSSLSAVISALLVPFYVWWFKPEFTFPVALVCCLLIYRHHDN
IQRLWRGQEDKVWAKFKKK