HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A871

Names and origin
Entry : E7A871 (unreviewed)
Entry name : E7A871_HAEIF
Protein names : Dihydroneopterin aldolase
Organism : Haemophilus influenzae F3031
Organism ID : 866630
ORF names : HIBPF_02090
History
Date of creation : 2011-03-08
Date of modification : 2012-11-28
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Predicted
Gene Ontology (GO)
GO term name : dihydroneopterin aldolase activity; folic acid-containing compound metabolic process
GO identifier : GO:0004150; GO:0006760
Reference
PubMed ID : 22377449
Protein sequence
Length : 126 residues
>E7A871|E7A871_HAEIF Haemophilus influenzae F3031
MDRIFIEELTVFAQIGVYDWEQQIKQKLVFDLEMAWDCKQAAETDDVAYCLNYAEVSQAI
IDYVESKPFLLIERVAYEVADLLESRYQLQGLKIKLSKPKAVAQARNVGVLIVRGCLK