HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A7P6

Names and origin
Entry : E7A7P6 (unreviewed)
Entry name : E7A7P6_HAEIF
Protein names : Endoribonuclease YbeY (EC 3.1.-.-)
Organism : Haemophilus influenzae F3031
Organism ID : 866630
Gene names : ybeY
ORF names : HIBPF_00040
EC number : 3.1.-.-
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : cytoplasm; endoribonuclease activity; metalloendopeptidase activity; nucleic acid phosphodiester bond hydrolysis; rRNA processing; zinc ion binding
GO identifier : GO:0005737; GO:0004521; GO:0004222; GO:0090305; GO:0006364; GO:0008270
Keywords
Ligand & Biological process : Cytoplasm; Endonuclease; Hydrolase; Metal-binding; Nuclease; Ribosome biogenesis; Zinc; rRNA processing
General annotation
Sequence similarities : Belongs to Endoribonuclease YbeY family
Subcellular location : Cytoplasm.
Reference
PubMed ID : 22377449
Protein sequence
Length : 166 residues
>E7A7P6|E7A7P6_HAEIF Haemophilus influenzae F3031
MGSVLVDLQIATENIEGLPTEEQIVQWATGAVQPEGNEVEMTVRIVDEAESHELNLTYRG
KDRPTNVLSFPFECPDEVELPLLGDLVICRQVVEREAAEQEKPLMAHWAHMVVHGSLHLL
GYDHIEDDEAEEMESLETQIMQGLGFDDPYLAEK