HIGDB - Haemophilus influenzae Genome Database

Protein search results for - E7A7L5

Names and origin
Entry : E7A7L5 (unreviewed)
Entry name : E7A7L5_HAEIF
Protein names : 50S ribosomal protein L19
Organism : Haemophilus influenzae F3031
Organism ID : 866630
Gene names : rplS
ORF names : HIBPF_20320
History
Date of creation : 2011-03-08
Date of modification : 2013-10-16
Date of sequence modification : 2011-03-08
Protein attributes
Protein existence : Inferred from homology
Gene Ontology (GO)
GO term name : ribosome; structural constituent of ribosome; translation
GO identifier : GO:0005840; GO:0003735; GO:0006412
Keywords
Ligand & Biological process : Ribonucleoprotein; Ribosomal protein
General annotation
Sequence similarities : Belongs to Ribosomal protein L19P family
Reference
PubMed ID : 22377449
Protein sequence
Length : 124 residues
>E7A7L5|E7A7L5_HAEIF Haemophilus influenzae F3031
MSNIIKQLEQEQLKQNVPSFRPGDTLEVKVWVVEGSKRRLQAFEGVVIAIRNRGLHSAFT
LRKVSNGVGVERVFQTHSPAVDSIAVKRKGAVRKAKLYYLRERSGKSARIKERLGA